PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9NG120800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRF
Protein Properties Length: 591aa    MW: 61498.5 Da    PI: 6.873
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9NG120800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC74.89.2e-24212255245
                  WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                           epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  Pavir.9NG120800.1.p 212 LEPGRCRRTDGKKWRCSRDAVADQKYCERHMNRGRHRSRKHVEG 255
                          69***************************************986 PP

2QLQ58.61.9e-20144179136
                  QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 
                          ++FT++Q+ +L++Q+l+yKyLaan P+Pp Ll++i+
  Pavir.9NG120800.1.p 144 GPFTPSQWIELEHQALIYKYLAANSPIPPSLLVPIR 179
                          59*********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.1E-11144180IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.295145180IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.3E-15145179IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.65211255IPR014977WRC domain
PfamPF088795.0E-20213254IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 591 aa     Download sequence    Send to blast
MELGGVVMDA GGGAAELGLL VGGSSRLLKH GRGNAAAGGE EHGWGGRAAK QARTAADAAE  60
AAKAAVAPFL LGSCSPGHGG EQMLSFSSAA ASSCASTAAV AAAAAAVAAD GAMPLYYGTP  120
ASCSGLSSVS LSSSMQGAMA RVRGPFTPSQ WIELEHQALI YKYLAANSPI PPSLLVPIRS  180
SIASSPYPPS YFGTSALGWG SFQLGYSGNA DLEPGRCRRT DGKKWRCSRD AVADQKYCER  240
HMNRGRHRSR KHVEGQPGHA AKAMSAAVAA AAATQPTALA ASGAGATAAG LTVSQHQQPV  300
KSYAAGATDP CSLQYNRELV NKQNENDNMQ DSDNLSMLTS MNTRNPGSLF PFSKQNNPFE  360
VTSSRPEFGL VSSDSLMSSP HSSLENVNVL SSQSLNENQS SASLQHFVDW PRTPAQGGLS  420
WADAEDMQAQ RSQLSISAPM ASSELSSAST SPIQEKLMLS PLKLSREYSP IGLSIAASRD  480
EVSQLEANWA TMFRDSSMGG PLGEVLTKNS NAEARHCLPA PLNLLTDCWD SSPGMESSPV  540
GVLQKTTFGS VSSSTGSSPR MENHGAYDGI SNLRDDLGSI VVNHPSIRLM *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.59860.0callus| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981896.10.0PREDICTED: growth-regulating factor 6-like
SwissprotQ6AWY30.0GRF6_ORYSJ; Growth-regulating factor 6
TrEMBLK4A7G60.0K4A7G6_SETIT; Uncharacterized protein
STRINGSi034822m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42903568
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.14e-44growth-regulating factor 2